Lineage for d1hwxc2 (1hwx C:1-208)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25651Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 25652Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 25653Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 25654Protein Glutamate dehydrogenase [53225] (5 species)
  7. 25662Species Cow (Bos taurus) [TaxId:9913] [53230] (3 PDB entries)
  8. 25665Domain d1hwxc2: 1hwx C:1-208 [33900]
    Other proteins in same PDB: d1hwxa1, d1hwxb1, d1hwxc1, d1hwxd1, d1hwxe1, d1hwxf1

Details for d1hwxc2

PDB Entry: 1hwx (more details), 2.5 Å

PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid

SCOP Domain Sequences for d1hwxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwxc2 c.58.1.1 (C:1-208) Glutamate dehydrogenase {Cow (Bos taurus)}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1hwxc2:

Click to download the PDB-style file with coordinates for d1hwxc2.
(The format of our PDB-style files is described here.)

Timeline for d1hwxc2: