Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
Protein automated matches [190995] (8 species) not a true protein |
Species Thermococcus thioreducens [TaxId:277988] [338977] (2 PDB entries) |
Domain d5txwd_: 5txw D: [338999] automated match to d1g2ia_ |
PDB Entry: 5txw (more details), 1.86 Å
SCOPe Domain Sequences for d5txwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5txwd_ c.23.16.2 (D:) automated matches {Thermococcus thioreducens [TaxId: 277988]} mkvlflsadgfedlelicplhrikeeghevyvasfergkitgkhgysvnvdlafeevgpd efdalvlpggrapeivrlnekaieitrkmfeagkpvasichgpqilisagvlkgrkgtst itirddvvnagaewvneevvvdgnwvssrhpgdlyawmrefvkllk
Timeline for d5txwd_: