Lineage for d5txwc_ (5txw C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2441326Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2441498Family c.23.16.2: DJ-1/PfpI [52325] (10 protein domains)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2441620Protein automated matches [190995] (8 species)
    not a true protein
  7. 2441638Species Thermococcus thioreducens [TaxId:277988] [338977] (2 PDB entries)
  8. 2441641Domain d5txwc_: 5txw C: [338997]
    automated match to d1g2ia_

Details for d5txwc_

PDB Entry: 5txw (more details), 1.86 Å

PDB Description: structure of pfp1 protease from thermococcus thioreducens: large cell h3 crystal form
PDB Compounds: (C:) Peptidase

SCOPe Domain Sequences for d5txwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5txwc_ c.23.16.2 (C:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mkvlflsadgfedlelicplhrikeeghevyvasfergkitgkhgysvnvdlafeevgpd
efdalvlpggrapeivrlnekaieitrkmfeagkpvasichgpqilisagvlkgrkgtst
itirddvvnagaewvneevvvdgnwvssrhpgdlyawmrefvkllk

SCOPe Domain Coordinates for d5txwc_:

Click to download the PDB-style file with coordinates for d5txwc_.
(The format of our PDB-style files is described here.)

Timeline for d5txwc_: