SCOP 1.55: Domain d1hwxb2: 1hwx B:1-208

Lineage for d1hwxb2 (1hwx B:1-208)

Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
Protein Glutamate dehydrogenase [53225] (5 species)
Species Cow (Bos taurus) [TaxId:9913] [53230] (3 PDB entries)
Domain d1hwxb2: 1hwx B:1-208 [33899]
Other proteins in same PDB: d1hwxa1, d1hwxb1, d1hwxc1, d1hwxd1, d1hwxe1, d1hwxf1

Details for d1hwxb2

PDB Entry: 1hwx (more details), 2.5 Å

PDB Description: crystal structure of bovine liver glutamate dehydrogenase complexed with gtp, nadh, and l-glutamic acid

SCOP Domain Sequences for d1hwxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwxb2 c.58.1.1 (B:1-208) Glutamate dehydrogenase {Cow (Bos taurus)}
adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1hwxb2:

Click to download the PDB-style file with coordinates for d1hwxb2.
(The format of our PDB-style files is described here.)

Timeline for d1hwxb2: