Lineage for d5tt8b_ (5tt8 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2402282Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2402283Protein automated matches [191011] (13 species)
    not a true protein
  7. 2402315Species Helicobacter pylori [TaxId:85962] [274562] (6 PDB entries)
  8. 2402341Domain d5tt8b_: 5tt8 B: [338985]
    automated match to d4ygfg_
    complexed with cl, d8w, gol, zn

Details for d5tt8b_

PDB Entry: 5tt8 (more details), 2.4 Å

PDB Description: crystal structure of the complex of helicobacter pylori alpha-carbonic anhydrase with benzolamide
PDB Compounds: (B:) Alpha-carbonic anhydrase

SCOPe Domain Sequences for d5tt8b_:

Sequence, based on SEQRES records: (download)

>d5tt8b_ b.74.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtqdkadlqfkyaaskpkav
ffthhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrll
vlaigfeegkenpnldpilegiqkkqnfkevaldaflpksinyyhfngsltappctegva
wfvieeplevsakqlaeikkrmknspnqrpvqpdyntviikssaetr

Sequence, based on observed residues (ATOM records): (download)

>d5tt8b_ b.74.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
tkwdyknkengphrwdklhkdfevcksgksqspiniehyyhtadlqfkyaaskpkavfft
hhtlkasfeptnhinyrghdyvldnvhfhapmeflinnktrplsahfvhkdakgrllvla
igfeegkenpnldpilegiqnfkevaldaflpksinyyhfngsltappctegvawfviee
plevsakqlaeikkrmknspnqrpvqpdyntviikssaetr

SCOPe Domain Coordinates for d5tt8b_:

Click to download the PDB-style file with coordinates for d5tt8b_.
(The format of our PDB-style files is described here.)

Timeline for d5tt8b_: