Lineage for d5tw0a_ (5tw0 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117752Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2117924Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2118046Protein automated matches [190995] (8 species)
    not a true protein
  7. 2118064Species Thermococcus thioreducens [TaxId:277988] [338977] (2 PDB entries)
  8. 2118069Domain d5tw0a_: 5tw0 A: [338979]
    automated match to d1g2ia_

Details for d5tw0a_

PDB Entry: 5tw0 (more details), 1.96 Å

PDB Description: structure of pfp1 protease from thermococcus thioreducens: small cell h3 crystal form
PDB Compounds: (A:) Peptidase

SCOPe Domain Sequences for d5tw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tw0a_ c.23.16.2 (A:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mkvlflsadgfedlelicplhrikeeghevyvasfergkitgkhgysvnvdlafeevgpd
efdalvlpggrapeivrlnekaieitrkmfeagkpvasichgpqilisagvlkgrkgtst
itirddvvnagaewvneevvvdgnwvssrhpgdlyawmrefvkllk

SCOPe Domain Coordinates for d5tw0a_:

Click to download the PDB-style file with coordinates for d5tw0a_.
(The format of our PDB-style files is described here.)

Timeline for d5tw0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5tw0b_