Lineage for d5t9xc_ (5t9x C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780728Species Bacteroides uniformis [TaxId:820] [338954] (1 PDB entry)
  8. 2780731Domain d5t9xc_: 5t9x C: [338968]
    automated match to d1o4za_
    complexed with imd, na

Details for d5t9xc_

PDB Entry: 5t9x (more details), 2.5 Å

PDB Description: crystal structure of bugh16bwt
PDB Compounds: (C:) glycoside hydrolase

SCOPe Domain Sequences for d5t9xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t9xc_ b.29.1.0 (C:) automated matches {Bacteroides uniformis [TaxId: 820]}
eyewdkfpvpvsagtgmkwelqsqsddfnytadsnnkgnfekkwtdyyhanwsgpaptiw
qrdhisvsdgclrietsrpddvkivkvtsgdkekmmpgtytgcvtsktrvvypvyveaya
kianstmasdvwmlspddtqeidiieaygsdrvvgddghkfygpdrihlshhvfirdpfq
dyqptdpgswykdvngtiwrndfhrvgvywkdpfnleyyvdgkmvrrvsgkniidpndft
kgtglskemdiiinmedqswraisglsptnkelmnkdnntflvdwiriykpved

SCOPe Domain Coordinates for d5t9xc_:

Click to download the PDB-style file with coordinates for d5t9xc_.
(The format of our PDB-style files is described here.)

Timeline for d5t9xc_: