SCOPe 2.07: Domain d5t5ua1: 5t5u A:101-262

Lineage for d5t5ua1 (5t5u A:101-262)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Neosartorya fumigata [TaxId:330879] [338948] (4 PDB entries)

8. Domain d5t5ua1: 5t5u A:101-262 [338959]
   automated match to d1iica1
   complexed with 75t, mya

Details for d5t5ua1

PDB Entry: 5t5u, 1.8 Å

PDB Description: crystal structure of aspergillus fumigatus n-myristoyl transferase in complex with myristoyl coa and a methylpyridyl-dipihenyl-pyridine ligand

PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5t5ua1:

Sequence; same for both SEQRES and ATOM records:

>d5t5ua1 d.108.1.0 (A:101-262) automated matches {Neosartorya fumigata [TaxId: 330879]}
ggpikiidpekvskepdallegfewatldltnetelqelwdlltyhyveddnamfrfrys
qsflhwalmspgwkkewhvgvratksrklvasicgvpteinvrnqklkvveinflcihkk
lrskrltpvlikeitrrcylngiyqaiytagvvlptpvsscr

Timeline for d5t5ua1:

• d5t5ua1 first appeared in SCOPe 2.06
  
• d5t5ua1 appears in the current release, SCOPe 2.08