Lineage for d5t93a_ (5t93 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366565Domain d5t93a_: 5t93 A: [338958]
    automated match to d3t0xa_
    complexed with act, zn

Details for d5t93a_

PDB Entry: 5t93 (more details), 1.9 Å

PDB Description: immunoglobulin light chain variable domain al-t05
PDB Compounds: (A:) ALT-05 immunoglobulin light chain variable domain from light chain amyloidosis patient

SCOPe Domain Sequences for d5t93a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t93a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsaapgqtvtiscsgsssnignnyvswyqhlpgtapkfliydnnkrpsgip
drfsgfksgtsatlgitglqtgdeadyycgtwdsslsalvfgggtkltvl

SCOPe Domain Coordinates for d5t93a_:

Click to download the PDB-style file with coordinates for d5t93a_.
(The format of our PDB-style files is described here.)

Timeline for d5t93a_: