Lineage for d5t9xa_ (5t9x A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2051881Species Bacteroides uniformis [TaxId:820] [338954] (1 PDB entry)
  8. 2051882Domain d5t9xa_: 5t9x A: [338956]
    automated match to d1o4za_
    complexed with imd, na

Details for d5t9xa_

PDB Entry: 5t9x (more details), 2.5 Å

PDB Description: crystal structure of bugh16bwt
PDB Compounds: (A:) glycoside hydrolase

SCOPe Domain Sequences for d5t9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t9xa_ b.29.1.0 (A:) automated matches {Bacteroides uniformis [TaxId: 820]}
setefeyewdkfpvpvsagtgmkwelqsqsddfnytadsnnkgnfekkwtdyyhanwsgp
aptiwqrdhisvsdgclrietsrpddvkivkvtsgdkekmmpgtytgcvtsktrvvypvy
veayakianstmasdvwmlspddtqeidiieaygsdrvvgddghkfygpdrihlshhvfi
rdpfqdyqptdpgswykdvngtiwrndfhrvgvywkdpfnleyyvdgkmvrrvsgkniid
pndftkgtglskemdiiinmedqswraisglsptnkelmnkdnntflvdwiriykpved

SCOPe Domain Coordinates for d5t9xa_:

Click to download the PDB-style file with coordinates for d5t9xa_.
(The format of our PDB-style files is described here.)

Timeline for d5t9xa_: