Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Bacteroides uniformis [TaxId:820] [338954] (1 PDB entry) |
Domain d5t9xa_: 5t9x A: [338956] automated match to d1o4za_ complexed with imd, na |
PDB Entry: 5t9x (more details), 2.5 Å
SCOPe Domain Sequences for d5t9xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t9xa_ b.29.1.0 (A:) automated matches {Bacteroides uniformis [TaxId: 820]} setefeyewdkfpvpvsagtgmkwelqsqsddfnytadsnnkgnfekkwtdyyhanwsgp aptiwqrdhisvsdgclrietsrpddvkivkvtsgdkekmmpgtytgcvtsktrvvypvy veayakianstmasdvwmlspddtqeidiieaygsdrvvgddghkfygpdrihlshhvfi rdpfqdyqptdpgswykdvngtiwrndfhrvgvywkdpfnleyyvdgkmvrrvsgkniid pndftkgtglskemdiiinmedqswraisglsptnkelmnkdnntflvdwiriykpved
Timeline for d5t9xa_: