SCOPe 2.08: Domain d5oomw_: 5oom w:

Lineage for d5oomw_ (5oom w:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255120] (5 PDB entries)

8. Domain d5oomw_: 5oom w: [338940]
   Other proteins in same PDB: d5oomu_
   automated match to d2qnwa_
   complexed with mg, pns, zn

Details for d5oomw_

PDB Entry: 5oom, 3.03 Å

PDB Description: structure of a native assembly intermediate of the human mitochondrial ribosome with unfolded interfacial rrna

PDB Compounds: (w:) acyl carrier protein, mitochondrial

SCOPe Domain Sequences for d5oomw_:

Sequence; same for both SEQRES and ATOM records:

>d5oomw_ a.28.1.0 (w:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltlegiqdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfeipdi
daeklmcpqeivdyiadkk

Timeline for d5oomw_:

• d5oomw_ first appeared in SCOPe 2.06
  
• d5oomw_ appears in SCOPe 2.07