Lineage for d5o30h_ (5o30 H:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2431535Species Ilumatobacter coccineus [TaxId:1313172] [338929] (1 PDB entry)
  8. 2431543Domain d5o30h_: 5o30 H: [338936]
    automated match to d1ybva_
    complexed with act, gol

Details for d5o30h_

PDB Entry: 5o30 (more details), 2.3 Å

PDB Description: crystal structure of the novel halohydrin dehalogenase hheg
PDB Compounds: (H:) Putative oxidoreductase

SCOPe Domain Sequences for d5o30h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o30h_ c.2.1.0 (H:) automated matches {Ilumatobacter coccineus [TaxId: 1313172]}
nrpvalitmatgyvgpalartmadrgfdlvlhgtagdgtmvgveesfdsqiadlakrgad
vltisdvdlttrtgnqsmiervlerfgrldsaclvtglivtgkfldmtddqwakvkatnl
dmvfhglqavlppmvaagagqcvvftsatggrpdpmvsiyggtragangivravglehar
hgvqvnaigtnymdfpgflkasradgdperramieaqvplrrlgtmdelssvtaglldgs
nrfqtgqffdfsggwga

SCOPe Domain Coordinates for d5o30h_:

Click to download the PDB-style file with coordinates for d5o30h_.
(The format of our PDB-style files is described here.)

Timeline for d5o30h_: