SCOPe 2.08: Domain d5ne3b_: 5ne3 B:

Lineage for d5ne3b_ (5ne3 B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Stenotrophomonas maltophilia [TaxId:522373] [338920] (1 PDB entry)

8. Domain d5ne3b_: 5ne3 B: [338927]
   automated match to d1hzoa_
   complexed with nxl

Details for d5ne3b_

PDB Entry: 5ne3, 1.35 Å

PDB Description: l2 class a serine-beta-lactamase complexed with avibactam

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5ne3b_:

Sequence; same for both SEQRES and ATOM records:

>d5ne3b_ e.3.1.0 (B:) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
aptdaaitaasdfaalekacagrlgvtlldtasgrrighrqderfpmcstfksmlaatvl
sqaermpalldrrvpvgeadllshapvtrrhagkdmtvrdlcratiitsdntaanllfgv
vggppavtaflrasgdtvsrsdrlepelnsfakgdprdtttpaamaatlqrvvlgevlqp
asrqqladwlidnetgdaclraglgkrwrvgdktgsngedarndiavlwpvaggapwvlt
aylqagaisyeqrasvlaqvgriadrlig

Timeline for d5ne3b_:

• d5ne3b_ first appeared in SCOPe 2.06
  
• d5ne3b_ appears in SCOPe 2.07