SCOPe 2.08: Domain d5oolu_: 5ool u:

Lineage for d5oolu_ (5ool u:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.0: automated matches [227287] (1 protein)
   not a true family

6. Protein automated matches [227105] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226559] (18 PDB entries)

8. Domain d5oolu_: 5ool u: [338923]
   Other proteins in same PDB: d5oolw_
   automated match to d3upsa_
   complexed with mg, pns, zn

Details for d5oolu_

PDB Entry: 5ool, 3.06 Å

PDB Description: structure of a native assembly intermediate of the human mitochondrial ribosome with unfolded interfacial rrna

PDB Compounds: (u:) Mitochondrial assembly of ribosomal large subunit protein 1

SCOPe Domain Sequences for d5oolu_:

Sequence; same for both SEQRES and ATOM records:

>d5oolu_ d.218.1.0 (u:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfdidmmvsllrqenardicviqvppemrytdyfvivsgtstrhlhamafyvvkmykhlk
ckrdphvkiegkdtddwlcvdfgsmvihlmlpetreiyeleklwtlrsydd

Timeline for d5oolu_:

• d5oolu_ first appeared in SCOPe 2.06
  
• d5oolu_ appears in SCOPe 2.07