SCOPe 2.06: Domain d5lyga_: 5lyg A:

Lineage for d5lyga_ (5lyg A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries)

8. Domain d5lyga_: 5lyg A: [338922]
   automated match to d4v1pa_
   complexed with edo, mli

Details for d5lyga_

PDB Entry: 5lyg, 1.6 Å

PDB Description: crystal structure of intracellular b30.2 domain of btn3a1 bound to malonate

PDB Compounds: (A:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d5lyga_:

Sequence; same for both SEQRES and ATOM records:

>d5lyga_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlg
cesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlte
prtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlept
alticpa

Timeline for d5lyga_:

• d5lyga_ is new in SCOPe 2.06-stable
  
• d5lyga_ appears in SCOPe 2.07
  
• d5lyga_ appears in the current release, SCOPe 2.08