![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (53 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries) |
![]() | Domain d5lyga_: 5lyg A: [338922] automated match to d4v1pa_ complexed with edo, mli |
PDB Entry: 5lyg (more details), 1.6 Å
SCOPe Domain Sequences for d5lyga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lyga_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} saynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlg cesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlte prtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltlept alticpa
Timeline for d5lyga_: