Lineage for d2tmgf2 (2tmg F:4-178)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317634Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 317635Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 317636Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 317637Protein Glutamate dehydrogenase [53225] (7 species)
  7. 317719Species Thermotoga maritima [TaxId:243274] [53229] (3 PDB entries)
  8. 317731Domain d2tmgf2: 2tmg F:4-178 [33891]
    Other proteins in same PDB: d2tmga1, d2tmgb1, d2tmgc1, d2tmgd1, d2tmge1, d2tmgf1

Details for d2tmgf2

PDB Entry: 2tmg (more details), 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e

SCOP Domain Sequences for d2tmgf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmgf2 c.58.1.1 (F:4-178) Glutamate dehydrogenase {Thermotoga maritima}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvel

SCOP Domain Coordinates for d2tmgf2:

Click to download the PDB-style file with coordinates for d2tmgf2.
(The format of our PDB-style files is described here.)

Timeline for d2tmgf2: