Lineage for d5ls0a_ (5ls0 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2384029Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2384030Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2384031Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2384121Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [257893] (2 PDB entries)
  8. 2384124Domain d5ls0a_: 5ls0 A: [338907]
    automated match to d4lugb_
    complexed with mg, peg

Details for d5ls0a_

PDB Entry: 5ls0 (more details), 1.83 Å

PDB Description: crystal structure of inorganic pyrophosphatase ppa1 from arabidopsis thaliana
PDB Compounds: (A:) Soluble inorganic pyrophosphatase 1

SCOPe Domain Sequences for d5ls0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ls0a_ b.40.5.1 (A:) Inorganic pyrophosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnygfvp
rtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeykhyt
dikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyil

SCOPe Domain Coordinates for d5ls0a_:

Click to download the PDB-style file with coordinates for d5ls0a_.
(The format of our PDB-style files is described here.)

Timeline for d5ls0a_: