Lineage for d5l7pb_ (5l7p B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442472Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2442706Protein automated matches [190581] (9 species)
    not a true protein
  7. 2442728Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (12 PDB entries)
  8. 2442733Domain d5l7pb_: 5l7p B: [338901]
    automated match to d4nd6a_
    complexed with 1pe, buu, ca, cl

Details for d5l7pb_

PDB Entry: 5l7p (more details), 1.9 Å

PDB Description: in silico-powered specific incorporation of photocaged dopa at multiple protein sites
PDB Compounds: (B:) Tyrosine--tRNA ligase

SCOPe Domain Sequences for d5l7pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l7pb_ c.26.1.1 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefemikrntseiiseeelrevlkkdeksaaigfepsgkihlghylqikkmidlqnagf
diiiiladlaaylnqkgeldeirkigdynkkvfeamglkakyvygsefaldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnaahymgvdvnvggmeqrkihmlq
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmrlknavaeelikile
pirkrl

SCOPe Domain Coordinates for d5l7pb_:

Click to download the PDB-style file with coordinates for d5l7pb_.
(The format of our PDB-style files is described here.)

Timeline for d5l7pb_: