Lineage for d2tmge2 (2tmg E:4-178)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890285Protein Glutamate dehydrogenase [53225] (8 species)
  7. 2890377Species Thermotoga maritima [TaxId:2336] [53229] (3 PDB entries)
  8. 2890388Domain d2tmge2: 2tmg E:4-178 [33890]
    Other proteins in same PDB: d2tmga1, d2tmgb1, d2tmgc1, d2tmgd1, d2tmge1, d2tmgf1
    mutant

Details for d2tmge2

PDB Entry: 2tmg (more details), 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e
PDB Compounds: (E:) protein (glutamate dehydrogenase)

SCOPe Domain Sequences for d2tmge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmge2 c.58.1.1 (E:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvel

SCOPe Domain Coordinates for d2tmge2:

Click to download the PDB-style file with coordinates for d2tmge2.
(The format of our PDB-style files is described here.)

Timeline for d2tmge2: