![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
![]() | Protein Triacylglycerol lipase [53559] (7 species) |
![]() | Species Pseudozyma antarctica [TaxId:84753] [278274] (4 PDB entries) |
![]() | Domain d5gv5b_: 5gv5 B: [338891] automated match to d1tcaa_ complexed with msw |
PDB Entry: 5gv5 (more details), 2.89 Å
SCOPe Domain Sequences for d5gv5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gv5b_ c.69.1.17 (B:) Triacylglycerol lipase {Pseudozyma antarctica [TaxId: 84753]} lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstqlg ytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffps irskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivptt nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsa lrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmpy arpfavgkrtcsgivtp
Timeline for d5gv5b_: