Lineage for d5h4ra_ (5h4r A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441159Species Caldicellulosiruptor sp. [TaxId:1214564] [311461] (2 PDB entries)
  8. 2441160Domain d5h4ra_: 5h4r A: [338885]
    automated match to d4x0vc_
    complexed with ctt, gol; mutant

Details for d5h4ra_

PDB Entry: 5h4r (more details), 1.7 Å

PDB Description: the complex of glycoside hydrolase 5 lichenase from caldicellulosiruptor sp. f32 e188q mutant and cellotetraose
PDB Compounds: (A:) Beta-1,3-1,4-glucanase

SCOPe Domain Sequences for d5h4ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4ra_ c.1.8.0 (A:) automated matches {Caldicellulosiruptor sp. [TaxId: 1214564]}
rakipeikiasrkipnnaalkfvkdmkigwnlgntfdaafenpsfddellyetawcgvkt
tkqmidtvkkagfntiripvswhnhvtgsnftiskrwldrvqqvvdyamknkmyviinih
hdimpgyyypnsqhlqtsikyvksiwtqvatrfknyndhlifeavnqprltgsrfewwld
mnnpecrdaveainklnqvfvdtvrstggnnvsrylmvpgyaaapeyvlidefkipkdss
kyknriiisvhayrpynfalqapnesgsvsewsvnseesrrdidyfmdklydkfvskgip
vvigefgardkngnlqsrvefaayyvraarargitccwwdnnafygngenfglldrktlk
wvypeivsammkyar

SCOPe Domain Coordinates for d5h4ra_:

Click to download the PDB-style file with coordinates for d5h4ra_.
(The format of our PDB-style files is described here.)

Timeline for d5h4ra_: