Lineage for d5gvya_ (5gvy A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402521Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2402563Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2402707Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2402708Protein automated matches [190516] (4 species)
    not a true protein
  7. 2402736Species Oryza sativa [TaxId:39946] [338879] (1 PDB entry)
  8. 2402737Domain d5gvya_: 5gvy A: [338882]
    automated match to d1x1va_
    complexed with man

Details for d5gvya_

PDB Entry: 5gvy (more details), 1.66 Å

PDB Description: crystal structure of salt protein from oryza sativa
PDB Compounds: (A:) Salt stress-induced protein

SCOPe Domain Sequences for d5gvya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gvya_ b.77.3.0 (A:) automated matches {Oryza sativa [TaxId: 39946]}
mtlvkiglwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggg
egtsteiklgssehikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplq
dsghvvgffgrsgtlidaigiyvhp

SCOPe Domain Coordinates for d5gvya_:

Click to download the PDB-style file with coordinates for d5gvya_.
(The format of our PDB-style files is described here.)

Timeline for d5gvya_: