![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:563041] [256091] (2 PDB entries) |
![]() | Domain d6apea2: 6ape A:126-288 [338878] Other proteins in same PDB: d6apea1 automated match to d4cjxb2 complexed with gol, na |
PDB Entry: 6ape (more details), 1.45 Å
SCOPe Domain Sequences for d6apea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6apea2 c.2.1.0 (A:126-288) automated matches {Helicobacter pylori [TaxId: 563041]} fhplnigklctqkesflpatpmgvmrllkhyhieikgkdvaiigasniigkplsmlmlna gasvsvchiltkdisfytqnadivcvgvgkpdlikasmlkkgavvvdiginhlndgrivg dvdftnaqkvagfitpvpkgvgpmtivsllentliafekqqrk
Timeline for d6apea2: