![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:563041] [338876] (1 PDB entry) |
![]() | Domain d6apea1: 6ape A:5-125 [338877] Other proteins in same PDB: d6apea2 automated match to d4cjxb1 complexed with gol, na |
PDB Entry: 6ape (more details), 1.45 Å
SCOPe Domain Sequences for d6apea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6apea1 c.58.1.0 (A:5-125) automated matches {Helicobacter pylori [TaxId: 563041]} gvvlldgqalaysiekdlknkiqiitvqvhkrpklavilvgkdpasityvnmkikacerv gmdfdlktlqenvteaellslikdyntdqnisgvlvqlplprhidskmvleaidpskdvd g
Timeline for d6apea1: