Lineage for d5y3ba_ (5y3b A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933417Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)
  8. 2933489Domain d5y3ba_: 5y3b A: [338863]
    Other proteins in same PDB: d5y3bc2, d5y3bf2
    automated match to d4wipc_

Details for d5y3ba_

PDB Entry: 5y3b (more details), 3 Å

PDB Description: crystal structure of mouse ccd1 dix domain
PDB Compounds: (A:) Dixin

SCOPe Domain Sequences for d5y3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y3ba_ d.15.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
stctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvkee
vfhdddaipgwegkivawveed

SCOPe Domain Coordinates for d5y3ba_:

Click to download the PDB-style file with coordinates for d5y3ba_.
(The format of our PDB-style files is described here.)

Timeline for d5y3ba_: