Lineage for d5y2xa1 (5y2x A:3-293)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900279Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2900319Protein automated matches [190880] (5 species)
    not a true protein
  7. 2900347Species Rhodococcus sp. [TaxId:1831] [189207] (19 PDB entries)
  8. 2900364Domain d5y2xa1: 5y2x A:3-293 [338861]
    Other proteins in same PDB: d5y2xa2
    automated match to d2v9za_
    complexed with cl

Details for d5y2xa1

PDB Entry: 5y2x (more details), 2.02 Å

PDB Description: crystal structure of apo-halotag (m175c)
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d5y2xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y2xa1 c.69.1.8 (A:3-293) automated matches {Rhodococcus sp. [TaxId: 1831]}
eigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrci
apdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnper
vkgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpcgvvrplt
evemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgt
pgvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstl

SCOPe Domain Coordinates for d5y2xa1:

Click to download the PDB-style file with coordinates for d5y2xa1.
(The format of our PDB-style files is described here.)

Timeline for d5y2xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y2xa2