![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
![]() | Protein automated matches [190880] (5 species) not a true protein |
![]() | Species Rhodococcus sp. [TaxId:1831] [189207] (19 PDB entries) |
![]() | Domain d5y2xa1: 5y2x A:3-293 [338861] Other proteins in same PDB: d5y2xa2 automated match to d2v9za_ complexed with cl |
PDB Entry: 5y2x (more details), 2.02 Å
SCOPe Domain Sequences for d5y2xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y2xa1 c.69.1.8 (A:3-293) automated matches {Rhodococcus sp. [TaxId: 1831]} eigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrci apdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnper vkgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpcgvvrplt evemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgt pgvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstl
Timeline for d5y2xa1: