![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein c-src tyrosine kinase [56155] (3 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56157] (56 PDB entries) |
![]() | Domain d5xp7a_: 5xp7 A: [338860] automated match to d3f6xa_ complexed with 8c6, gol, mg |
PDB Entry: 5xp7 (more details), 2.01 Å
SCOPe Domain Sequences for d5xp7a_:
Sequence, based on SEQRES records: (download)
>d5xp7a_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk lrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmay vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc qcwrkdpeerptfeylqafledyftstepqyqpgenl
>d5xp7a_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk lrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmay vermnyvhrdlraanilvgenlvckvadfglarlifpikwtapeaalygrftiksdvwsf gilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerpt feylqafledyftstepqyqpgenl
Timeline for d5xp7a_: