SCOP 1.55: Domain d2tmga2: 2tmg A:4-178

Lineage for d2tmga2 (2tmg A:4-178)

Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
Protein Glutamate dehydrogenase [53225] (5 species)
Species Thermotoga maritima [TaxId:243274] [53229] (3 PDB entries)
Domain d2tmga2: 2tmg A:4-178 [33886]
Other proteins in same PDB: d2tmga1, d2tmgb1, d2tmgc1, d2tmgd1, d2tmge1, d2tmgf1

Details for d2tmga2

PDB Entry: 2tmg (more details), 2.9 Å

PDB Description: thermotoga maritima glutamate dehydrogenase mutant s128r, t158e, n117r, s160e

SCOP Domain Sequences for d2tmga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tmga2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrrelerls
rrffreiqviigpyndipapdvntnadviawymdeyemnvghtvlgivtgkpvel

SCOP Domain Coordinates for d2tmga2:

Click to download the PDB-style file with coordinates for d2tmga2.
(The format of our PDB-style files is described here.)

Timeline for d2tmga2: