Lineage for d1b26f2 (1b26 F:4-178)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25651Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
  4. 25652Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families) (S)
  5. 25653Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
  6. 25654Protein Glutamate dehydrogenase [53225] (5 species)
  7. 25692Species Thermotoga maritima [TaxId:243274] [53229] (3 PDB entries)
  8. 25698Domain d1b26f2: 1b26 F:4-178 [33885]
    Other proteins in same PDB: d1b26a1, d1b26b1, d1b26c1, d1b26d1, d1b26e1, d1b26f1

Details for d1b26f2

PDB Entry: 1b26 (more details), 3 Å

PDB Description: glutamate dehydrogenase

SCOP Domain Sequences for d1b26f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b26f2 c.58.1.1 (F:4-178) Glutamate dehydrogenase {Thermotoga maritima}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvel

SCOP Domain Coordinates for d1b26f2:

Click to download the PDB-style file with coordinates for d1b26f2.
(The format of our PDB-style files is described here.)

Timeline for d1b26f2: