SCOPe 2.06: Domain d5y3bd_: 5y3b D:

Lineage for d5y3bd_ (5y3b D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d5y3bd_: 5y3b D: [338844]
   Other proteins in same PDB: d5y3bc2, d5y3bf2
   automated match to d4wipc_

Details for d5y3bd_

PDB Entry: 5y3b, 3 Å

PDB Description: crystal structure of mouse ccd1 dix domain

PDB Compounds: (D:) Dixin

SCOPe Domain Sequences for d5y3bd_:

Sequence; same for both SEQRES and ATOM records:

>d5y3bd_ d.15.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvkeev
fhdddaipgwegkivawveed

Timeline for d5y3bd_:

• d5y3bd_ is new in SCOPe 2.06-stable
  
• d5y3bd_ appears in SCOPe 2.07
  
• d5y3bd_ appears in the current release, SCOPe 2.08