Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries) |
Domain d5y3be_: 5y3b E: [338838] Other proteins in same PDB: d5y3bc2, d5y3bf2 automated match to d4wipc_ |
PDB Entry: 5y3b (more details), 3 Å
SCOPe Domain Sequences for d5y3be_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y3be_ d.15.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} stctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvkee vfhdddaipgwegkivawveed
Timeline for d5y3be_: