Lineage for d5xfdb1 (5xfd B:2-160)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780663Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries)
  8. 2780667Domain d5xfdb1: 5xfd B:2-160 [338834]
    Other proteins in same PDB: d5xfda2, d5xfdb2
    automated match to d1ww7a_

Details for d5xfdb1

PDB Entry: 5xfd (more details), 1.5 Å

PDB Description: serial femtosecond x-ray structure of agrocybe cylindracea galectin with lactose solved by se-sad using xfel (refined against 60,000 patterns)
PDB Compounds: (B:) Galactoside-binding lectin

SCOPe Domain Sequences for d5xfdb1:

Sequence, based on SEQRES records: (download)

>d5xfdb1 b.29.1.0 (B:2-160) automated matches {Agrocybe cylindracea [TaxId: 64608]}
ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
tviqytkqisgttsslsynstegtsifstvveavtytgl

Sequence, based on observed residues (ATOM records): (download)

>d5xfdb1 b.29.1.0 (B:2-160) automated matches {Agrocybe cylindracea [TaxId: 64608]}
ttsavniynisagasvdlaapvttgdivtffssalnlsnntalnllsengayllhiafrl
qenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinektviqyt
kqisgttsslsynstsifstvveavtytgl

SCOPe Domain Coordinates for d5xfdb1:

Click to download the PDB-style file with coordinates for d5xfdb1.
(The format of our PDB-style files is described here.)

Timeline for d5xfdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xfdb2