Lineage for d5xjpa_ (5xjp A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115097Species Acinetobacter baumannii [TaxId:470] [328556] (3 PDB entries)
  8. 2115099Domain d5xjpa_: 5xjp A: [338833]
    automated match to d2mska_
    complexed with mg

Details for d5xjpa_

PDB Entry: 5xjp (more details), 1.6 Å

PDB Description: crystal structure of response regulator ader receiver domain with mg
PDB Compounds: (A:) AdeR

SCOPe Domain Sequences for d5xjpa_:

Sequence, based on SEQRES records: (download)

>d5xjpa_ c.23.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
cqdkvilvveddydigdiienylkregmsviramngkqaielhasqpidlilldiklpel
ngwevlnkirqkaqtpvimltaldqdidkvmalrigaddfvvkpfnpneviarvqavlrr
t

Sequence, based on observed residues (ATOM records): (download)

>d5xjpa_ c.23.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
cqdkvilvveddydigdiienylkregmsviramngkqaielhasqpidlilldiklpel
ngwevlnkirqkaqtpvimltaldidkvmalrigaddfvvkpfnpneviarvqavlrrt

SCOPe Domain Coordinates for d5xjpa_:

Click to download the PDB-style file with coordinates for d5xjpa_.
(The format of our PDB-style files is described here.)

Timeline for d5xjpa_: