Lineage for d5xfda1 (5xfd A:2-160)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2051837Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries)
  8. 2051842Domain d5xfda1: 5xfd A:2-160 [338831]
    Other proteins in same PDB: d5xfda2, d5xfdb2
    automated match to d1ww7a_
    complexed with a2g, fuc, gal, ndg

Details for d5xfda1

PDB Entry: 5xfd (more details), 1.5 Å

PDB Description: serial femtosecond x-ray structure of agrocybe cylindracea galectin with lactose solved by se-sad using xfel (refined against 60,000 patterns)
PDB Compounds: (A:) Galactoside-binding lectin

SCOPe Domain Sequences for d5xfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xfda1 b.29.1.0 (A:2-160) automated matches {Agrocybe cylindracea [TaxId: 64608]}
ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
tviqytkqisgttsslsynstegtsifstvveavtytgl

SCOPe Domain Coordinates for d5xfda1:

Click to download the PDB-style file with coordinates for d5xfda1.
(The format of our PDB-style files is described here.)

Timeline for d5xfda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5xfda2