SCOPe 2.06: Domain d5whka2: 5whk A:177-270

Lineage for d5whka2 (5whk A:177-270)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5whka2: 5whk A:177-270 [338827]
   Other proteins in same PDB: d5whka1, d5whkb_, d5whkl2
   automated match to d3frua1
   complexed with edo, nhe

Details for d5whka2

PDB Entry: 5whk, 2.5 Å

PDB Description: crystal structure of fab fragment of antibody dx-2507 bound to fcrn- b2m

PDB Compounds: (A:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d5whka2:

Sequence; same for both SEQRES and ATOM records:

>d5whka2 b.1.1.0 (A:177-270) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvelesp

Timeline for d5whka2:

• d5whka2 is new in SCOPe 2.06-stable
  
• d5whka2 appears in SCOPe 2.07
  
• d5whka2 appears in the current release, SCOPe 2.08