| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) ![]() |
| Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
| Protein Glutamate dehydrogenase [53225] (7 species) |
| Species Thermotoga maritima [TaxId:243274] [53229] (3 PDB entries) |
| Domain d1b26c2: 1b26 C:4-178 [33882] Other proteins in same PDB: d1b26a1, d1b26b1, d1b26c1, d1b26d1, d1b26e1, d1b26f1 |
PDB Entry: 1b26 (more details), 3 Å
SCOP Domain Sequences for d1b26c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b26c2 c.58.1.1 (C:4-178) Glutamate dehydrogenase {Thermotoga maritima}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvel
Timeline for d1b26c2: