SCOP 1.55: Domain d1b26c2: 1b26 C:4-178

Lineage for d1b26c2 (1b26 C:4-178)

Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (3 families)
Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
Protein Glutamate dehydrogenase [53225] (5 species)
Species Thermotoga maritima [TaxId:243274] [53229] (3 PDB entries)
Domain d1b26c2: 1b26 C:4-178 [33882]
Other proteins in same PDB: d1b26a1, d1b26b1, d1b26c1, d1b26d1, d1b26e1, d1b26f1

Details for d1b26c2

PDB Description: glutamate dehydrogenase

SCOP Domain Sequences for d1b26c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b26c2 c.58.1.1 (C:4-178) Glutamate dehydrogenase {Thermotoga maritima}
slyemaveqfnraaslmdlesdlaevlrrpkrvlivefpvrmddghvevftgyrvqhnva
rgpakggiryhpdvtldevkalafwmtwktavmnlpfgggkggvrvdpkklsrnelerls
rrffseiqviigpyndipapdvntnadviawymdtysmnvghtvlgivtgkpvel

SCOP Domain Coordinates for d1b26c2:

Click to download the PDB-style file with coordinates for d1b26c2.
(The format of our PDB-style files is described here.)

Timeline for d1b26c2: