Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.0: automated matches [227256] (1 protein) not a true family |
Protein automated matches [227041] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [338807] (2 PDB entries) |
Domain d5wqjb1: 5wqj B:5-151 [338811] automated match to d1rhsa1 complexed with 7n3, na |
PDB Entry: 5wqj (more details), 1.2 Å
SCOPe Domain Sequences for d5wqjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wqjb1 c.46.1.0 (B:5-151) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qlfralvsaqwvaealkaprssqplklldaswylpklgrdarrefeerhipgaaffdidr ssdhtspydhmlpnathfadyagslgvsaathvviydgsdqglysaprvwwmfrafghhs vslldggfrhwlnqnlpissgkshsep
Timeline for d5wqjb1: