SCOPe 2.08: Domain d5wnnb_: 5wnn B:

Lineage for d5wnnb_ (5wnn B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:272560] [338801] (1 PDB entry)

8. Domain d5wnnb_: 5wnn B: [338805]
   automated match to d1ixha_
   complexed with k, po4

Details for d5wnnb_

PDB Entry: 5wnn, 1.85 Å

PDB Description: crystal structure of phosphate-binding protein psts protein from burkholderia pseudomallei

PDB Compounds: (B:) Phosphate-binding protein PstS

SCOPe Domain Sequences for d5wnnb_:

Sequence; same for both SEQRES and ATOM records:

>d5wnnb_ c.94.1.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
aditgagstfampiytkwaadyqqsggakvnyqgigssgglkqivaktvdfagsdaplkd
delakeglfqfptvvggvvpvinvpgvkageltlsgavlgdiylgkikkwndpaiaalnp
kvklpdtdiavvrradgsgtsfiwtnylskvndewkskvgegttvnwptgtggkgndgva
afvqrlpgaigyvewayakknnmvytalknstgtvvepktetfkaaaaganwsksfyqil
tnqpgkeawpvvgatfvllhakqdkpaqgaetlkffdwafkngakaaddldyislpasve
teirkqwkvkvtdaagkava

Timeline for d5wnnb_:

• d5wnnb_ first appeared in SCOPe 2.06
  
• d5wnnb_ appears in SCOPe 2.07