Lineage for d5wfnb2 (5wfn B:147-375)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883908Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (13 PDB entries)
  8. 2883930Domain d5wfnb2: 5wfn B:147-375 [338796]
    Other proteins in same PDB: d5wfna1, d5wfnb1
    automated match to d3ub5a2
    complexed with anp, mg

Details for d5wfnb2

PDB Entry: 5wfn (more details), 3 Å

PDB Description: revised model of leiomodin 2-mediated actin regulation (alternate refinement of pdb 4rwt)
PDB Compounds: (B:) Actin-5C

SCOPe Domain Sequences for d5wfnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wfnb2 c.55.1.1 (B:147-375) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmeacgihettynsimkcdvdiredlyantvlsggttmypgiadrmqkeitalakstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

SCOPe Domain Coordinates for d5wfnb2:

Click to download the PDB-style file with coordinates for d5wfnb2.
(The format of our PDB-style files is described here.)

Timeline for d5wfnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wfnb1