Lineage for d5wfnb1 (5wfn B:6-146)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2492872Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226691] (4 PDB entries)
  8. 2492881Domain d5wfnb1: 5wfn B:6-146 [338795]
    Other proteins in same PDB: d5wfna2, d5wfnb2
    automated match to d2btfa1
    complexed with anp, mg

Details for d5wfnb1

PDB Entry: 5wfn (more details), 3 Å

PDB Description: revised model of leiomodin 2-mediated actin regulation (alternate refinement of pdb 4rwt)
PDB Compounds: (B:) Actin-5C

SCOPe Domain Sequences for d5wfnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wfnb1 c.55.1.0 (B:6-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe
tfntpamyvaiqavlslyasg

SCOPe Domain Coordinates for d5wfnb1:

Click to download the PDB-style file with coordinates for d5wfnb1.
(The format of our PDB-style files is described here.)

Timeline for d5wfnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wfnb2