Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226691] (4 PDB entries) |
Domain d5wfnb1: 5wfn B:6-146 [338795] Other proteins in same PDB: d5wfna2, d5wfnb2 automated match to d2btfa1 complexed with anp, mg |
PDB Entry: 5wfn (more details), 3 Å
SCOPe Domain Sequences for d5wfnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wfnb1 c.55.1.0 (B:6-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe tfntpamyvaiqavlslyasg
Timeline for d5wfnb1: