SCOPe 2.08: Domain d5vxlb_: 5vxl B:

Lineage for d5vxlb_ (5vxl B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)

8. Domain d5vxlb_: 5vxl B: [338793]
   Other proteins in same PDB: d5vxla_
   automated match to d1mqkh_

Details for d5vxlb_

PDB Entry: 5vxl, 2.8 Å

PDB Description: 2.80 a resolution structure of ipad from shigella flexneri in complex with single-domain antibody jps-g3

PDB Compounds: (B:) single-domain antibody JPS-G3

SCOPe Domain Sequences for d5vxlb_:

Sequence; same for both SEQRES and ATOM records:

>d5vxlb_ b.1.1.0 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlaesggglvqpggslrlscsasggvfiiynmgwyrqapgkqrelvasidsysgsitn
yadsvkgrftisrdnvekrvylemnnlkpedtavyycnanlrtnnywgqgtqvtvs

Timeline for d5vxlb_:

• d5vxlb_ first appeared in SCOPe 2.06
  
• d5vxlb_ appears in SCOPe 2.07