Lineage for d5vxjj_ (5vxj J:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2025070Species Vicugna pacos [TaxId:30538] [189756] (35 PDB entries)
  8. 2025117Domain d5vxjj_: 5vxj J: [338792]
    Other proteins in same PDB: d5vxja_, d5vxjc_, d5vxje_, d5vxjg_, d5vxji_
    automated match to d1mqkh_

Details for d5vxjj_

PDB Entry: 5vxj (more details), 2.5 Å

PDB Description: 2.50 a resolution structure of ipad from shigella flexneri in complex with single-domain antibody jmk-e3
PDB Compounds: (J:) single-domain antibody JMK-E3

SCOPe Domain Sequences for d5vxjj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vxjj_ b.1.1.1 (J:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlaetggglaqpggslrlscaasgftfsravmnwyrqapgkerelvariydaggngsi
adpvkgrftisrdnakntvhlqmnslkpedtamyvcnagifdgnyrtywgqgtqvtv

SCOPe Domain Coordinates for d5vxjj_:

Click to download the PDB-style file with coordinates for d5vxjj_.
(The format of our PDB-style files is described here.)

Timeline for d5vxjj_: