SCOPe 2.08: Domain d5vxka_: 5vxk A:

Lineage for d5vxka_ (5vxk A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.250: IpaD-like [140692] (1 superfamily)
   6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest

4. Superfamily a.250.1: IpaD-like [140693] (2 families)

5. Family a.250.1.1: IpaD-like [140694] (3 proteins)
   Pfam PF06511

6. Protein automated matches [191266] (1 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [189835] (7 PDB entries)

8. Domain d5vxka_: 5vxk A: [338790]
   Other proteins in same PDB: d5vxkb_
   automated match to d2j0oa1

Details for d5vxka_

PDB Entry: 5vxk, 2.55 Å

PDB Description: 2.55 a resolution structure of ipad from shigella flexneri in complex with single-domain antibody jmk-h2

PDB Compounds: (A:) invasin ipad

SCOPe Domain Sequences for d5vxka_:

Sequence; same for both SEQRES and ATOM records:

>d5vxka_ a.250.1.1 (A:) automated matches {Shigella flexneri [TaxId: 623]}
vssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqlldils
rneypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavssy
tqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntvsq
eqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqawn
agfsaedetmknnlqtlvqkysnansifdnlvkvlsstisss

Timeline for d5vxka_:

• d5vxka_ first appeared in SCOPe 2.06
  
• d5vxka_ appears in SCOPe 2.07