Lineage for d5vxka_ (5vxk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016066Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 2016067Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 2016068Family a.250.1.1: IpaD-like [140694] (3 protein domains)
    Pfam PF06511
  6. 2016085Protein automated matches [191266] (1 species)
    not a true protein
  7. 2016086Species Shigella flexneri [TaxId:623] [189835] (7 PDB entries)
  8. 2295489Domain d5vxka_: 5vxk A: [338790]
    Other proteins in same PDB: d5vxkb_
    automated match to d2j0oa1

Details for d5vxka_

PDB Entry: 5vxk (more details), 2.55 Å

PDB Description: 2.55 a resolution structure of ipad from shigella flexneri in complex with single-domain antibody jmk-h2
PDB Compounds: (A:) invasin ipad

SCOPe Domain Sequences for d5vxka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vxka_ a.250.1.1 (A:) automated matches {Shigella flexneri [TaxId: 623]}
vssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqlldils
rneypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavssy
tqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntvsq
eqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqawn
agfsaedetmknnlqtlvqkysnansifdnlvkvlsstisss

SCOPe Domain Coordinates for d5vxka_:

Click to download the PDB-style file with coordinates for d5vxka_.
(The format of our PDB-style files is described here.)

Timeline for d5vxka_:

  • d5vxka_ appears in periodic updates to SCOPe 2.06 starting on 2017-09-08

View in 3D
Domains from other chains:
(mouse over for more information)
d5vxkb_