Lineage for d1bvuf2 (1bvu F:3-180)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 398612Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 398613Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 398614Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 398615Protein Glutamate dehydrogenase [53225] (7 species)
  7. 398620Species Archaeon Thermococcus litoralis [TaxId:2265] [53228] (1 PDB entry)
  8. 398626Domain d1bvuf2: 1bvu F:3-180 [33879]
    Other proteins in same PDB: d1bvua1, d1bvub1, d1bvuc1, d1bvud1, d1bvue1, d1bvuf1

Details for d1bvuf2

PDB Entry: 1bvu (more details), 2.5 Å

PDB Description: glutamate dehydrogenase from thermococcus litoralis

SCOP Domain Sequences for d1bvuf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvuf2 c.58.1.1 (F:3-180) Glutamate dehydrogenase {Archaeon Thermococcus litoralis}
qdpfeiavkqleraaqymdiseealeflkrpqrivevsipvemddgsvkvftgfrvqynw
argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggvicnpkemsdrekerl
argyvraiydvispytdipapdvytnpqimawmmdeyetisrrkdpsfgvitgkppsv

SCOP Domain Coordinates for d1bvuf2:

Click to download the PDB-style file with coordinates for d1bvuf2.
(The format of our PDB-style files is described here.)

Timeline for d1bvuf2: