Lineage for d5vwqd_ (5vwq D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2470825Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2470885Protein Aspartate aminotransferase, AAT [53385] (9 species)
  7. 2470920Species Escherichia coli [TaxId:562] [53390] (84 PDB entries)
    Uniprot P00509
  8. 2470950Domain d5vwqd_: 5vwq D: [338781]
    automated match to d1arta_
    complexed with pmp

Details for d5vwqd_

PDB Entry: 5vwq (more details), 1.8 Å

PDB Description: e.coli aspartate aminotransferase-(1r,3s,4s)-3-amino-4- fluorocyclopentane-1-carboxylic acid (fcp)
PDB Compounds: (D:) aspartate aminotransferase

SCOPe Domain Sequences for d5vwqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vwqd_ c.67.1.1 (D:) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]}
mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
lreefgvyavasgrvnvagmtpdnmaplceaivavl

SCOPe Domain Coordinates for d5vwqd_:

Click to download the PDB-style file with coordinates for d5vwqd_.
(The format of our PDB-style files is described here.)

Timeline for d5vwqd_: