Lineage for d5w8va1 (5w8v A:4-216)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891453Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)
  7. 2891454Species Human (Homo sapiens) [TaxId:9606] [53284] (20 PDB entries)
  8. 2891501Domain d5w8va1: 5w8v A:4-216 [338770]
    Other proteins in same PDB: d5w8va2
    automated match to d4rade_
    complexed with 9yp, mg

Details for d5w8va1

PDB Entry: 5w8v (more details), 2.35 Å

PDB Description: human hgprt in complex with [(2-[(guanin-9-yl)methyl]propane-1,3- diyl)bis(oxy)]bis(methylene)diphosphonic acid
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5w8va1:

Sequence, based on SEQRES records: (download)

>d5w8va1 c.61.1.1 (A:4-216) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
dkfvvgyaldyneyfrdlnhvcvisetgkakyk

Sequence, based on observed residues (ATOM records): (download)

>d5w8va1 c.61.1.1 (A:4-216) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksyikviggddlstltgknvli
vediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeipdkfvvgya
ldyneyfrdlnhvcvisetgkakyk

SCOPe Domain Coordinates for d5w8va1:

Click to download the PDB-style file with coordinates for d5w8va1.
(The format of our PDB-style files is described here.)

Timeline for d5w8va1: