| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries) |
| Domain d5vxkb_: 5vxk B: [338769] Other proteins in same PDB: d5vxka_ automated match to d3cx5j_ |
PDB Entry: 5vxk (more details), 2.55 Å
SCOPe Domain Sequences for d5vxkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vxkb_ b.1.1.0 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
lqlvesggglvqpggslrlscaasgftlddqpiawfrqapgkeregvscisidgntqsys
dsvkgrftisrdtannrvhlqmnnlkpedtavyycaadrytsvrqmctmieglhrvwgqg
tqvtv
Timeline for d5vxkb_: