SCOPe 2.08: Domain d5vxkb_: 5vxk B:

Lineage for d5vxkb_ (5vxk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)

8. Domain d5vxkb_: 5vxk B: [338769]
   Other proteins in same PDB: d5vxka_
   automated match to d3cx5j_

Details for d5vxkb_

PDB Entry: 5vxk, 2.55 Å

PDB Description: 2.55 a resolution structure of ipad from shigella flexneri in complex with single-domain antibody jmk-h2

PDB Compounds: (B:) single-domain antibody JMK-H2

SCOPe Domain Sequences for d5vxkb_:

Sequence; same for both SEQRES and ATOM records:

>d5vxkb_ b.1.1.0 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
lqlvesggglvqpggslrlscaasgftlddqpiawfrqapgkeregvscisidgntqsys
dsvkgrftisrdtannrvhlqmnnlkpedtavyycaadrytsvrqmctmieglhrvwgqg
tqvtv

Timeline for d5vxkb_:

• d5vxkb_ first appeared in SCOPe 2.06
  
• d5vxkb_ appears in SCOPe 2.07