Lineage for d5vxjg_ (5vxj G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016066Fold a.250: IpaD-like [140692] (1 superfamily)
    6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest
  4. 2016067Superfamily a.250.1: IpaD-like [140693] (2 families) (S)
  5. 2016068Family a.250.1.1: IpaD-like [140694] (3 protein domains)
    Pfam PF06511
  6. 2016085Protein automated matches [191266] (1 species)
    not a true protein
  7. 2016086Species Shigella flexneri [TaxId:623] [189835] (7 PDB entries)
  8. 2295467Domain d5vxjg_: 5vxj G: [338768]
    Other proteins in same PDB: d5vxjb_, d5vxjd_, d5vxjf_, d5vxjh_, d5vxjj_
    automated match to d2j0oa1

Details for d5vxjg_

PDB Entry: 5vxj (more details), 2.5 Å

PDB Description: 2.50 a resolution structure of ipad from shigella flexneri in complex with single-domain antibody jmk-e3
PDB Compounds: (G:) invasin ipad

SCOPe Domain Sequences for d5vxjg_:

Sequence, based on SEQRES records: (download)

>d5vxjg_ a.250.1.1 (G:) automated matches {Shigella flexneri [TaxId: 623]}
ssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqlldilsr
neypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavssyt
qmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntvsqe
qankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqawna
gfsaedetmknnlqtlvqkysnansifdnlvkvlsstis

Sequence, based on observed residues (ATOM records): (download)

>d5vxjg_ a.250.1.1 (G:) automated matches {Shigella flexneri [TaxId: 623]}
ssltmlndtlhnirttnqalkkelsqktleeialhssqismdvnksaqlldilsrneypi
nkdarellhsapkeaeldgdqmishrelwakiansindineqylkvyehavssytqmyqd
fsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplypanntvsqeqankw
ltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldnakyqawnagfsae
detmknnlqtlvqkysnansifdnlvkvlsstis

SCOPe Domain Coordinates for d5vxjg_:

Click to download the PDB-style file with coordinates for d5vxjg_.
(The format of our PDB-style files is described here.)

Timeline for d5vxjg_:

  • d5vxjg_ appears in periodic updates to SCOPe 2.06 starting on 2017-09-08